PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000194.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 223aa    MW: 24919.8 Da    PI: 7.3662
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000194.1_g00015.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1802.1e-5639134297
                    NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                              +eqdrflPianv+rimkkv+P+n+kisk+aketvqecvsefisfvt+easdkcqrekrktingdd+lwa++tlGfedyv+plk+yl
  Itr_sc000194.1_g00015.1  39 KEQDRFLPIANVGRIMKKVIPGNGKISKEAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDILWAITTLGFEDYVNPLKLYL 124
                              89************************************************************************************ PP

                    NF-YB  88 kkyrelegek 97 
                              +kyre+egek
  Itr_sc000194.1_g00015.1 125 NKYREIEGEK 134
                              *******996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.0E-5135146IPR009072Histone-fold
SuperFamilySSF471132.48E-4041145IPR009072Histone-fold
PfamPF008085.6E-2844108IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.0E-207290No hitNo description
PROSITE patternPS0068507591IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006156.0E-2091109No hitNo description
PRINTSPR006156.0E-20110128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MMTTTTAEND ERQTGNLPNL AVVRASPESS KTTNSANNKE QDRFLPIANV GRIMKKVIPG  60
NGKISKEAKE TVQECVSEFI SFVTGEASDK CQREKRKTIN GDDILWAITT LGFEDYVNPL  120
KLYLNKYREI EGEKLNLPKQ PPQLQQPPSS AANLAYNAAA TNVYSSSPAT LLSHHHHQPS  180
YMSSSDHHHH LLHQQFPNLA FSPQNSVQSQ LTKQEQIDSV GHW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B3e-4639129292Transcription factor HapC (Eurofung)
4g91_B3e-4639129292Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003524310.13e-78PREDICTED: nuclear transcription factor Y subunit B-7-like
SwissprotQ9SIT93e-73NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLA0A0B2RPC73e-78A0A0B2RPC7_GLYSO; Nuclear transcription factor Y subunit B-7
TrEMBLI1K5113e-78I1K511_SOYBN; Uncharacterized protein
STRINGGLYMA05G32680.19e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.14e-66nuclear factor Y, subunit B7